RBM3, Recombinant, Human, aa1-157, His-Tag (Putative RNA-binding Protein 3)

Product Overview

• Article Name: RBM3, Recombinant, Human, aa1-157, His-Tag (Putative RNA-binding Protein 3)
• Biozol Catalog Number: USB-375003
• Supplier Catalog Number: 375003
• Alternative Catalog Number: USB-375003-20,USB-375003-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation. Source: Recombinant protein corresponding to aa1-157 from human RBM3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.17kD Amino Acid Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19.17
• UniProt: P98179
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.