RecR, Recombinant, E. coli, aa1-201, His-SUMO-Tag (Recombination Protein RecR)

Product Overview

• Article Name: RecR, Recombinant, E. coli, aa1-201, His-SUMO-Tag (Recombination Protein RecR)
• Biozol Catalog Number: USB-375021
• Supplier Catalog Number: 375021
• Alternative Catalog Number: USB-375021-20,USB-375021-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. Source: Recombinant protein corresponding to aa1-201 from E. coli recR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.0kD Amino Acid Sequence: MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38
• UniProt: P0A7H6
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.