RelG, Recombinant, Mycobacterium Tuberculosis, aa1-87, His-SUMO-Tag (Toxin RelG)

Catalog Number: USB-375031
Article Name: RelG, Recombinant, Mycobacterium Tuberculosis, aa1-87, His-SUMO-Tag (Toxin RelG)
Biozol Catalog Number: USB-375031
Supplier Catalog Number: 375031
Alternative Catalog Number: USB-375031-20, USB-375031-100
Manufacturer: US Biological
Category: Molekularbiologie
Toxic component of a toxin-antitoxin (TA) module. Has RNase activity and preferentially cleaves at the 3-end of purine ribonucleotides. Overexpression in M.tuberculosis or M.smegmatis inhibits colony formation in a bacteriostatic rather than bacteriocidal fashion. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB2 (shown only for M.smegmatis). Overexpression also increases the number of gentamicin-tolerant and levofloxacin-tolerant persister cells. Source: Recombinant protein corresponding to aa1-87 from mycobacterium tuberculosis relG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.2kD Amino Acid Sequence: MPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.2
UniProt: O33348
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.