Renin Receptor, Recombinant, Human, aa17-350, His-Tag (ATP6AP2)

Catalog Number: USB-375036
Article Name: Renin Receptor, Recombinant, Human, aa17-350, His-Tag (ATP6AP2)
Biozol Catalog Number: USB-375036
Supplier Catalog Number: 375036
Alternative Catalog Number: USB-375036-20, USB-375036-100, USB-375036-1
Manufacturer: US Biological
Category: Molekularbiologie
This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. Recombinant protein corresponding to aa17-350 from human Renin Receptor, fused to His-Tag, expressed in E. coli. Molecular Weight: ~41.5kD Amino Acid Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.5
UniProt: O75787
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol.