RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)

Catalog Number: USB-375038
Article Name: RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)
Biozol Catalog Number: USB-375038
Supplier Catalog Number: 375038
Alternative Catalog Number: USB-375038-20, USB-375038-100
Manufacturer: US Biological
Category: Molekularbiologie
This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo. Source: Recombinant protein corresponding to aa1-311 from staphylococcus aureus Replication Initiation Protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.5kD Amino Acid Sequence: MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.5
UniProt: P03065
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.