RETNLB, Recombinant, Human, aa24-111, His-Tag (Resistin-like beta)

Catalog Number: USB-375046
Article Name: RETNLB, Recombinant, Human, aa24-111, His-Tag (Resistin-like beta)
Biozol Catalog Number: USB-375046
Supplier Catalog Number: 375046
Alternative Catalog Number: USB-375046-20, USB-375046-100, USB-375046-1
Manufacturer: US Biological
Category: Molekularbiologie
Probable hormone. Source: Recombinant protein corresponding to aa24-111 from human RETNLB, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~13.4kD Amino Acid Sequence: QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.4
UniProt: Q9BQ08
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.