RGS10, Recombinant, Human, aa1-181, GST-Tag (Regulator of G-protein Signaling 10)

Catalog Number: USB-375050
Article Name: RGS10, Recombinant, Human, aa1-181, GST-Tag (Regulator of G-protein Signaling 10)
Biozol Catalog Number: USB-375050
Supplier Catalog Number: 375050
Alternative Catalog Number: USB-375050-20,USB-375050-100,USB-375050-1
Manufacturer: US Biological
Category: Molekularbiologie
Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein. Source: Recombinant protein corresponding to aa1-181 from human RGS10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.2kD Amino Acid Sequence: MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 48.2
UniProt: O43665
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.