RGS5, Recombinant, Human, aa1-181, GST-Tag (Regulator of G-Protein Signaling 5)

Catalog Number: USB-375052
Article Name: RGS5, Recombinant, Human, aa1-181, GST-Tag (Regulator of G-Protein Signaling 5)
Biozol Catalog Number: USB-375052
Supplier Catalog Number: 375052
Alternative Catalog Number: USB-375052-20,USB-375052-100,USB-375052-1
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. Source: Recombinant protein corresponding to aa1-181 from human RGS5, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.9kD Amino Acid Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.9
UniProt: O15539
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.