Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag

Catalog Number: USB-375061
Article Name: Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag
Biozol Catalog Number: USB-375061
Supplier Catalog Number: 375061
Alternative Catalog Number: USB-375061-20, USB-375061-100
Manufacturer: US Biological
Category: Molekularbiologie
Required for the transport of riboflavin to the developing oocyte. Source: Recombinant protein corresponding to aa18-225 from chicken, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.8kD Amino Acid Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.8
UniProt: P02752
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.