Ribosyldihydronicotinamide Dehydrogenase, Recombinant, Rat, aa1-231, His-Tag (Nqo2)

Product Overview

• Article Name: Ribosyldihydronicotinamide Dehydrogenase, Recombinant, Rat, aa1-231, His-Tag (Nqo2)
• Biozol Catalog Number: USB-375065
• Supplier Catalog Number: 375065
• Alternative Catalog Number: USB-375065-20, USB-375065-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. Source: Recombinant protein corresponding to aa1-231 from rat Ribosyldihydronicotinamide Dehydrogenase, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.3kD Amino Acid Sequence: MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.3
• UniProt: Q6AY80
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.