RPS10, Recombinant, Human, aa4-165, GST-Tag (40S Ribosomal Protein S10)

Product Overview

• Article Name: RPS10, Recombinant, Human, aa4-165, GST-Tag (40S Ribosomal Protein S10)
• Biozol Catalog Number: USB-375132
• Supplier Catalog Number: 375132
• Alternative Catalog Number: USB-375132-20,USB-375132-100,USB-375132-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Component of the 40S ribosomal subunit. Source: Recombinant protein corresponding to aa4-165 from human RPS10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.5kD Amino Acid Sequence: PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 45.5
• UniProt: P46783
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.