RPS19BP1, Recombinant, Human, aa1-145, GST-Tag (Active Regulator of SIRT1 Protein)

Catalog Number: USB-375139
Article Name: RPS19BP1, Recombinant, Human, aa1-145, GST-Tag (Active Regulator of SIRT1 Protein)
Biozol Catalog Number: USB-375139
Supplier Catalog Number: 375139
Alternative Catalog Number: USB-375139-20,USB-375139-100,USB-375139-1
Manufacturer: US Biological
Category: Molekularbiologie
Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity. Source: Recombinant protein corresponding to aa1-145 from human AROS, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.4kD Amino Acid Sequence: MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.4
UniProt: Q86WX3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.