RpsS, Recombinant, E. coli, aa2-92, His-Tag (30S Ribosomal Protein S19)

Product Overview

• Article Name: RpsS, Recombinant, E. coli, aa2-92, His-Tag (30S Ribosomal Protein S19)
• Biozol Catalog Number: USB-375157
• Supplier Catalog Number: 375157
• Alternative Catalog Number: USB-375157-20,USB-375157-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

In the E. coli 70S ribosome in the initiation state it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a, this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states, contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder. Source: Recombinant protein corresponding to aa2-92 from E. coli RpsS, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD Amino Acid Sequence: PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14.3
• UniProt: P0A7U3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.