S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)

Catalog Number: USB-375172
Article Name: S1, Recombinant, Infectious Bronchitis Virus, aa230-539, GST-Tag (Spike Glycoprotein S1 Subunit)
Biozol Catalog Number: USB-375172
Supplier Catalog Number: 375172
Alternative Catalog Number: USB-375172-20,USB-375172-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa230-539 from infectious bronchitis virus Spike Glycoprotein S1 Subunit, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62kD Amino Acid Sequence: LACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 62
UniProt: D9IAI3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.