Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum Amyloid A-1 Protein)

Catalog Number: USB-375189
Article Name: Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum Amyloid A-1 Protein)
Biozol Catalog Number: USB-375189
Supplier Catalog Number: 375189
Alternative Catalog Number: USB-375189-20,USB-375189-100
Manufacturer: US Biological
Category: Molekularbiologie
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD Amino Acid Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.8
UniProt: P05366
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.