Major acute phase reactant. Apolipoprotein of the HDL complex. Recombinant protein corresponding to aa20-122 from mouse Saa3 with a 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.8kD Amino Acid Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY Purity (SDS-PAGE): 90% Form: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
