SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)

Catalog Number: USB-375194
Article Name: SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)
Biozol Catalog Number: USB-375194
Supplier Catalog Number: 375194
Alternative Catalog Number: USB-375194-20,USB-375194-100
Manufacturer: US Biological
Category: Molekularbiologie
This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease. Source: Recombinant protein corresponding to aa1-390 from streptomyces achromogenes saclM, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~59.3kD Amino Acid Sequence: MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 59.3
UniProt: O31073
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.