SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)

Catalog Number: USB-375201
Article Name: SAP130, Recombinant, Mouse, aa845-1057, His-Tag (Histone Deacetylase Complex Subunit Sap130)
Biozol Catalog Number: USB-375201
Supplier Catalog Number: 375201
Alternative Catalog Number: USB-375201-20,USB-375201-100
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. Source: Recombinant protein corresponding to aa845-1057 from mouse Sap130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.8kD Amino Acid Sequence: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.8
UniProt: Q8BIH0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.