Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor)

Catalog Number: USB-375222
Article Name: Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor)
Biozol Catalog Number: USB-375222
Supplier Catalog Number: 375222
Alternative Catalog Number: USB-375222-20,USB-375222-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity). Source: Recombinant protein corresponding to aa32-116 from staphylococcus aureus Scn, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.8kD Amino Acid Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.8
UniProt: Q99SU9
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.