SCO2, Recombinant, Human, aa43-226, His-SUMO-Tag (SCO2 Homolog, Mitochondrial)

Catalog Number: USB-375223
Article Name: SCO2, Recombinant, Human, aa43-226, His-SUMO-Tag (SCO2 Homolog, Mitochondrial)
Biozol Catalog Number: USB-375223
Supplier Catalog Number: 375223
Alternative Catalog Number: USB-375223-20,USB-375223-100,USB-375223-1
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2). Source: Recombinant protein corresponding to aa43-266 from human SCO2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.1kD Amino Acid Sequence: PAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.1
UniProt: O43819
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.