SDHA, Recombinant, Human, aa44-293, His-Tag (Succinate Dehydrogenase [Ubiquinone] Flavoprotein Subunit, Mitochondrial Protein)

Catalog Number: USB-375237
Article Name: SDHA, Recombinant, Human, aa44-293, His-Tag (Succinate Dehydrogenase [Ubiquinone] Flavoprotein Subunit, Mitochondrial Protein)
Biozol Catalog Number: USB-375237
Supplier Catalog Number: 375237
Alternative Catalog Number: USB-375237-20, USB-375237-100, USB-375237-1
Manufacturer: US Biological
Category: Molekularbiologie
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor. Source: Partial recombinant protein corresponding to aa44-293 from human SDHA, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD Amino Acid Sequence: SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.1
UniProt: P31040
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.