SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)

Catalog Number: USB-375250
Article Name: SEPP1, Recombinant, Human, aa20-381, His-Tag (Selenoprotein P)
Biozol Catalog Number: USB-375250
Supplier Catalog Number: 375250
Alternative Catalog Number: USB-375250-20, USB-375250-100, USB-375250-1
Manufacturer: US Biological
Category: Molekularbiologie
Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Recombinant protein corresponding to aa20-381 from human SEPP1, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P49908 Molecular Weight: ~44.6kD Amino Acid Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.6
UniProt: P49908
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol