Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. Source: Recombinant protein corresponding to aa20-381 from human Selenoprotein P, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.6kD Amino Acid Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
