SIVA1, Recombinant, Human, aa1-110, His-Tag (Apoptosis Regulatory Protein Siva)

Catalog Number: USB-375308
Article Name: SIVA1, Recombinant, Human, aa1-110, His-Tag (Apoptosis Regulatory Protein Siva)
Biozol Catalog Number: USB-375308
Supplier Catalog Number: 375308
Alternative Catalog Number: USB-375308-20,USB-375308-100
Manufacturer: US Biological
Category: Molekularbiologie
Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis. Source: Recombinant protein corresponding to aa1-110 from human SIVA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.8kD Amino Acid Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.8
UniProt: O15304
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.