SLC20A3, Recombinant, Human, aa47-87, GST-Tag (Tricarboxylate Transport Protein)

Catalog Number: USB-375314
Article Name: SLC20A3, Recombinant, Human, aa47-87, GST-Tag (Tricarboxylate Transport Protein)
Biozol Catalog Number: USB-375314
Supplier Catalog Number: 375314
Alternative Catalog Number: USB-375314-20,USB-375314-100,USB-375314-1
Manufacturer: US Biological
Category: Molekularbiologie
Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway. Source: Recombinant protein corresponding to aa47-87 from human SLC20A3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.8
UniProt: P53007
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.