SLURP1, Recombinant, Human, aa23-103, His-Tag (Secreted Ly-6/uPAR-related Protein 1)
Biozol Catalog Number:
USB-375327
Supplier Catalog Number:
375327
Alternative Catalog Number:
USB-375327-20,USB-375327-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Source: Recombinant protein corresponding to aa23-103 from human SLURP1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD Amino Acid Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted