SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)

Catalog Number: USB-375342
Article Name: SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)
Biozol Catalog Number: USB-375342
Supplier Catalog Number: 375342
Alternative Catalog Number: USB-375342-20,USB-375342-100
Manufacturer: US Biological
Category: Molekularbiologie
Not known, suppressor of MIF2 mutations. Recombinant protein corresponding to aa2-98 from Saccharomyces cerevisiae SMT3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/UniProt: Q12306 Molecular Weight: ~13.1kD Amino Acid Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.1
UniProt: Q12306
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol