SNAP29, Recombinant, Human, aa1-258, GST-Tag (Synaptosomal-associated Protein 29)

Catalog Number: USB-375349
Article Name: SNAP29, Recombinant, Human, aa1-258, GST-Tag (Synaptosomal-associated Protein 29)
Biozol Catalog Number: USB-375349
Supplier Catalog Number: 375349
Alternative Catalog Number: USB-375349-20,USB-375349-100,USB-375349-1
Manufacturer: US Biological
Category: Molekularbiologie
SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions. Source: Recombinant protein corresponding to aa1-258 from human SNAP29, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.0kD Amino Acid Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 56
UniProt: O95721
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.