SNCG, Recombinant, Human, aa1-127, His-SUMO-Tag (Gamma-synuclein)

Catalog Number: USB-375354
Article Name: SNCG, Recombinant, Human, aa1-127, His-SUMO-Tag (Gamma-synuclein)
Biozol Catalog Number: USB-375354
Supplier Catalog Number: 375354
Alternative Catalog Number: USB-375354-20,USB-375354-100,USB-375354-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. Source: Recombinant protein corresponding to aa1-127 from human SNCG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.3KD Amino Acid Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.3
UniProt: O76070
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.