SNPH, Recombinant, Human, aa1-424, His-SUMO-Tag (Syntaphilin)

Catalog Number: USB-375355
Article Name: SNPH, Recombinant, Human, aa1-424, His-SUMO-Tag (Syntaphilin)
Biozol Catalog Number: USB-375355
Supplier Catalog Number: 375355
Alternative Catalog Number: USB-375355-20,USB-375355-100,USB-375355-1
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits SNARE complex formation by absorbing free syntaxin-1. Source: Recombinant protein corresponding to aa1-424 from human SNPH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62kD Amino Acid Sequence: MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 62
UniProt: O15079
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.