SNRPD2, Recombinant, Human, aa1-118, GST-Tag (Small Nuclear Ribonucleoprotein Sm D2)

Product Overview

• Article Name: SNRPD2, Recombinant, Human, aa1-118, GST-Tag (Small Nuclear Ribonucleoprotein Sm D2)
• Biozol Catalog Number: USB-375359
• Supplier Catalog Number: 375359
• Alternative Catalog Number: USB-375359-20,USB-375359-100,USB-375359-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in an heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. Source: Recombinant protein corresponding to aa1-118 from human SNRPD2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.5kD Amino Acid Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 40.5
• UniProt: P62316
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.