Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa. Source: Recombinant protein corresponding to aa24-80 from mouse Spink3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.1kD Amino Acid Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
