SPRR3, Recombinant, Human, aa2-169, His-SUMO-Tag (Small Proline-rich Protein 3)

Catalog Number: USB-375397
Article Name: SPRR3, Recombinant, Human, aa2-169, His-SUMO-Tag (Small Proline-rich Protein 3)
Biozol Catalog Number: USB-375397
Supplier Catalog Number: 375397
Alternative Catalog Number: USB-375397-20,USB-375397-100,USB-375397-1
Manufacturer: US Biological
Category: Molekularbiologie
Cross-linked envelope protein of keratinocytes. Source: Recombinant protein corresponding to aa2-169 from human SPRR3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34kD Amino Acid Sequence: SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34
UniProt: Q9UBC9
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.