SRM, Recombinant, Human, aa17-302, GST-Tag (Spermidine Synthase)

Catalog Number: USB-375407
Article Name: SRM, Recombinant, Human, aa17-302, GST-Tag (Spermidine Synthase)
Biozol Catalog Number: USB-375407
Supplier Catalog Number: 375407
Alternative Catalog Number: USB-375407-20,USB-375407-100,USB-375407-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine. Source: Recombinant protein corresponding to aa17-302 from human SRM, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.4kD Amino Acid Sequence: REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 59.4
UniProt: P19623
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.