SRP19, Recombinant, Human, aa2-144, His-SUMO-Tag (Signal Recognition Particle 19kD Protein)

Catalog Number: USB-375409
Article Name: SRP19, Recombinant, Human, aa2-144, His-SUMO-Tag (Signal Recognition Particle 19kD Protein)
Biozol Catalog Number: USB-375409
Supplier Catalog Number: 375409
Alternative Catalog Number: USB-375409-20,USB-375409-100,USB-375409-1
Manufacturer: US Biological
Category: Molekularbiologie
Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54kD subunit of the SRP. Source: Recombinant protein corresponding to aa2-144 from human SRP19, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32kD Amino Acid Sequence: ACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32
UniProt: P09132
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.