SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein)

Catalog Number: USB-375418
Article Name: SSB, Recombinant, Bacillus anthracis, aa1-172, His-SUMO-Tag (Single-stranded DNA-binding Protein)
Biozol Catalog Number: USB-375418
Supplier Catalog Number: 375418
Alternative Catalog Number: USB-375418-20,USB-375418-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Full length recombinant protein corresponding to aa1-172 from bacillus anthracis SSB, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.7kD Amino Acid Sequence: MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.7
UniProt: Q81JI3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.