sspB, Recombinant, Staphylococcus aureus, aa220-393, GST-Tag (Staphopain B)
Biozol Catalog Number:
USB-375422
Supplier Catalog Number:
375422
Alternative Catalog Number:
USB-375422-20,USB-375422-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other Extracellular domain proteases is involved in colonization and infection of human tissues. Source: Recombinant protein corresponding to aa220-393 from staphylococcus aureus sspB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.9kD Amino Acid Sequence: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted