ST8SIA4, Recombinant, Human, aa21-168, His-SUMO-Tag (CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase)

Catalog Number: USB-375428
Article Name: ST8SIA4, Recombinant, Human, aa21-168, His-SUMO-Tag (CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase)
Biozol Catalog Number: USB-375428
Supplier Catalog Number: 375428
Alternative Catalog Number: USB-375428-20,USB-375428-100,USB-375428-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells. Source: Recombinant protein corresponding to aa21-168 from human ST8SIA4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.8kD Amino Acid Sequence: KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.8
UniProt: Q92187
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.