Thpo, Recombinant, Rat, aa22-194, GST-Tag (Thrombopoietin)

Product Overview

• Article Name: Thpo, Recombinant, Rat, aa22-194, GST-Tag (Thrombopoietin)
• Biozol Catalog Number: USB-375559
• Supplier Catalog Number: 375559
• Alternative Catalog Number: USB-375559-20,USB-375559-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. Source: Recombinant protein corresponding to aa22-194 from rat Thrombopoietin, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.6kD Amino Acid Sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 45.6
• UniProt: P49745
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.