Thrombin-like Enzyme Crotalase, Recombinant, Crotalus Adamanteus, aa25-262, His-Tag

Catalog Number: USB-375561
Article Name: Thrombin-like Enzyme Crotalase, Recombinant, Crotalus Adamanteus, aa25-262, His-Tag
Biozol Catalog Number: USB-375561
Supplier Catalog Number: 375561
Alternative Catalog Number: USB-375561-20,USB-375561-100
Manufacturer: US Biological
Category: Molekularbiologie
Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA). Shows both kinin-releasing and coagulant activities. Recombinant protein corresponding to aa25-262 from crotalus adamanteus Thrombin-like enzyme crotalase, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.8kD Amino Acid Sequence: VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.8
UniProt: F8S114
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.