Thyroglobulin, Recombinant, Rat, aa21-300, HIs-SUMO-Tag (Tg)

Product Overview

• Article Name: Thyroglobulin, Recombinant, Rat, aa21-300, HIs-SUMO-Tag (Tg)
• Biozol Catalog Number: USB-375566
• Supplier Catalog Number: 375566
• Alternative Catalog Number: USB-375566-20,USB-375566-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). Source: Recombinant protein corresponding to aa21-300 from rat Tg, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~48.0kD Amino Acid Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 48
• UniProt: P06882
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.