TIMP4, Recombinant, Bovine, aa30-224, His-Tag (Metalloproteinase Inhibitor 4)

Catalog Number: USB-375580
Article Name: TIMP4, Recombinant, Bovine, aa30-224, His-Tag (Metalloproteinase Inhibitor 4)
Biozol Catalog Number: USB-375580
Supplier Catalog Number: 375580
Alternative Catalog Number: USB-375580-20,USB-375580-100
Manufacturer: US Biological
Category: Molekularbiologie
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Source: Recombinant protein corresponding to aa30-224 from bovine TIMP4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.5kD Amino Acid Sequence: CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.5
UniProt: O97563
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.