TMEM141, Recombinant, Human, aa1-108, GST-Tag (Transmembrane Protein 141)

Product Overview

• Article Name: TMEM141, Recombinant, Human, aa1-108, GST-Tag (Transmembrane Protein 141)
• Biozol Catalog Number: USB-375597
• Supplier Catalog Number: 375597
• Alternative Catalog Number: USB-375597-20,USB-375597-100,USB-375597-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-108 from human TMEM141, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.9kD Amino Acid Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 38.9
• UniProt: Q96I45
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.