TMEM14B, Recombinant, Human, aa1-114, GST-Tag (Transmembrane Protein 14B)

Catalog Number: USB-375598
Article Name: TMEM14B, Recombinant, Human, aa1-114, GST-Tag (Transmembrane Protein 14B)
Biozol Catalog Number: USB-375598
Supplier Catalog Number: 375598
Alternative Catalog Number: USB-375598-20,USB-375598-100,USB-375598-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-114 from human TMEM14B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.1kD Amino Acid Sequence: MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.1
UniProt: Q9NUH8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.