Tmk, Recombinant, Mycobacterium tuberculosis, aa1-214, His-SUMO-Tag (Thymidylate Kinase)

Catalog Number: USB-375602
Article Name: Tmk, Recombinant, Mycobacterium tuberculosis, aa1-214, His-SUMO-Tag (Thymidylate Kinase)
Biozol Catalog Number: USB-375602
Supplier Catalog Number: 375602
Alternative Catalog Number: USB-375602-20,USB-375602-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Source: Recombinant protein corresponding to aa1-214 from mycobacterium tuberculosis tmk, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.6
UniProt: P9WKE0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.