TRMT112, Recombinant, Human, aa1-125, His-SUMO-Tag (tRNA Methyltransferase 112 Homolog)

Catalog Number: USB-375683
Article Name: TRMT112, Recombinant, Human, aa1-125, His-SUMO-Tag (tRNA Methyltransferase 112 Homolog)
Biozol Catalog Number: USB-375683
Supplier Catalog Number: 375683
Alternative Catalog Number: USB-375683-20,USB-375683-100,USB-375683-1
Manufacturer: US Biological
Category: Molekularbiologie
Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on Gln-185, using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species. Source: Recombinant protein corresponding to aa1-125 from full length human TRMT112, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.2kD Amino Acid Sequence: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.2
UniProt: Q9UI30
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.