UL128, Recombinant, Human Cytomegalovirus, aa1-171, His-Tag (Uncharacterized Protein UL128)

Catalog Number: USB-375769
Article Name: UL128, Recombinant, Human Cytomegalovirus, aa1-171, His-Tag (Uncharacterized Protein UL128)
Biozol Catalog Number: USB-375769
Supplier Catalog Number: 375769
Alternative Catalog Number: USB-375769-20,USB-375769-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant full length protein corresponding to aa1-171 from human cytomegalovirus (strain AD169) (HHV-5) UL128, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.7kD Amino Acid Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.7
UniProt: P16837
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.