UL99, Recombinant, Human, aa2-190, His-Tag (Cytomegalovirus Tegument Protein UL99)

Product Overview

• Article Name: UL99, Recombinant, Human, aa2-190, His-Tag (Cytomegalovirus Tegument Protein UL99)
• Biozol Catalog Number: USB-375774
• Supplier Catalog Number: 375774
• Alternative Catalog Number: USB-375774-20,USB-375774-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery. Source: Recombinant protein corresponding to aa2-190 from human Cytomegalovirus Tegument Protein UL99, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD Amino Acid Sequence: GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 24.9
• UniProt: P13200
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.