UPF0454 Protein C12orf49, Recombinant, Human, aa34-205, His-SUMO-Tag (C12orf49)

Catalog Number: USB-375786
Article Name: UPF0454 Protein C12orf49, Recombinant, Human, aa34-205, His-SUMO-Tag (C12orf49)
Biozol Catalog Number: USB-375786
Supplier Catalog Number: 375786
Alternative Catalog Number: USB-375786-20,USB-375786-100,USB-375786-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa34-205 from human C12orf49, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.7kD Amino Acid Sequence: TFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.7
UniProt: Q9H741
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.