UspA, Recombinant, Salmonella Typhi, aa2-144, His-Tag (Universal Stress Protein A)

Product Overview

• Article Name: UspA, Recombinant, Salmonella Typhi, aa2-144, His-Tag (Universal Stress Protein A)
• Biozol Catalog Number: USB-375797
• Supplier Catalog Number: 375797
• Alternative Catalog Number: USB-375797-20,USB-375797-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for resistance to DNA-damaging agents. Source: Recombinant protein corresponding to aa2-144 from salmonella typhi uspA, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~19.9kD Amino Acid Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19.9
• UniProt: Q8Z268
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.